PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_005730_imit.t1
Common NameSOVF_005730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family HB-PHD
Protein Properties Length: 697aa    MW: 79008.9 Da    PI: 7.985
Description HB-PHD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_005730_imit.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-094825241153
                        HHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
           Homeobox  11 qleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                         l+ L ++F +n  ps++ +e++++ +g++ ++V  WF+N R+
  Sp_005730_imit.t1 482 TLKKLRQAFSENELPSRDVKEKISELVGIEYAKVNKWFKNARY 524
                        6899*************************************97 PP

2PHD32.42.2e-11233288151
                        SBTTTSS..TCTTSSEEEBS.SSSSEEETTTSTSSSSHHSHHSS..TBSSHHHHTT CS
                PHD   1 rCkvCgk..sdeegelvlCd.gCkewfHlkClglkleseekpeg..ewlCeeCkek 51 
                        +Ck C++    e+++++lCd +C+ +fH+kC++++l + ++p +   wlC+ C++k
  Sp_005730_imit.t1 233 ICKKCKSqeVSEDNDIILCDgTCNCAFHQKCIDPPLATIDIPPEdeGWLCKYCDCK 288
                        6999*9987678********56*******************99999*******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF579036.64E-13224291IPR011011Zinc finger, FYVE/PHD-type
Gene3DG3DSA:3.30.40.101.1E-10229288IPR013083Zinc finger, RING/FYVE/PHD-type
PROSITE profilePS5001610.451231288IPR019787Zinc finger, PHD-finger
SMARTSM002492.2E-8233286IPR001965Zinc finger, PHD-type
PfamPF006281.3E-8233288IPR019787Zinc finger, PHD-finger
CDDcd155047.24E-28234285No hitNo description
PROSITE patternPS013590234285IPR019786Zinc finger, PHD-type, conserved site
SMARTSM003893.0E-4471533IPR001356Homeobox domain
CDDcd000861.23E-6481533No hitNo description
PROSITE profilePS5007110.511481529IPR001356Homeobox domain
SuperFamilySSF466891.15E-7481533IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-8481533IPR009057Homeodomain-like
PfamPF000466.2E-7482524IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009733Biological Processresponse to auxin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 697 aa     Download sequence    Send to blast
MHGGGEKLCL LEFNLYPKSV KTKLKMKTLA QMRNGVLKKL NKKRKLGFSS LVMSSGTRLL  60
KQTDQKRKVE LETTGEELIH KKDDSEGHQI DFSKKRDHKE CQGDKPLCSS SKGKKDSGGS  120
ETVSLKRMRK QKRKKDKVVK DEAAQMQRRV RYLLVKMKLE QNLIDAYSGE GWKGQSREKI  180
RPEKELQRAK NQILKCKLGI RDTVYQLELL GSVGQIDDSL ISPDGSVHHE HIICKKCKSQ  240
EVSEDNDIIL CDGTCNCAFH QKCIDPPLAT IDIPPEDEGW LCKYCDCKME ILEATNAHLG  300
TEFTADSPWQ DIFKEEALLS NVETGDINPE EEWPDDESDD NDYDPDRDEN DRGNRCGMED  360
SDSHEDTSTS SSCCSLESEV LLDSGFSAGR HGISINIASL HQNCATDSND TEIASGPRKR  420
GAVDYRTLYD EMFGKDTNIG DIYSEDEDWD PSKKRRRKKE SDVASTLMTL CESEAKHSDL  480
ETLKKLRQAF SENELPSRDV KEKISELVGI EYAKVNKWFK NARYMALKTK KREAALDCSP  540
KQSDSAIGKA TEVIVSKCPS TPILTHKKKR LKKVSWKANL TTLLSPSKKH KLMKTSLGYT  600
KTNGELSDDM SLKKHLLHLK ANSRQKKVVK RSTESLEGQS EEKLMEHLFC LETKLWKLKQ  660
VLSTVEKVIN NESDDLSLDK QKVVYVPVAE IKEKTLC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13644LKKLNKKRK
2127134MRKQKRKK
3128135RKQKRKKD
4452457KKRRRK
5452458KKRRRKK
6454459RRRKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010671751.10.0PREDICTED: pathogenesis-related homeodomain protein
SwissprotP487851e-127PRH_ARATH; Pathogenesis-related homeodomain protein
TrEMBLA0A0K9S1620.0A0A0K9S162_SPIOL; Uncharacterized protein
STRINGVIT_11s0103g00650.t011e-178(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29940.22e-83pathogenesis related homeodomain protein A